Placeholder image of a protein
Icon representing a puzzle

1224: Unsolved De-novo Freestyle 78

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 25, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA

Top groups


  1. Avatar for Deleted group 11. Deleted group pts. 8,489
  2. Avatar for BOINC@Poland 12. BOINC@Poland 4 pts. 8,231
  3. Avatar for It's over 9000! 13. It's over 9000! 3 pts. 8,093
  4. Avatar for Team South Africa 14. Team South Africa 2 pts. 7,914
  5. Avatar for Deleted group 15. Deleted group pts. 7,461
  6. Avatar for SETI.Germany 16. SETI.Germany 1 pt. 7,245
  7. Avatar for Mojo Risin' 17. Mojo Risin' 1 pt. 7,125
  8. Avatar for GUGITBIOTECH 18. GUGITBIOTECH 1 pt. 6,872
  9. Avatar for Natural Abilities 19. Natural Abilities 1 pt. 6,785
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 4,598

  1. Avatar for YGK 81. YGK Lv 1 12 pts. 8,379
  2. Avatar for Deleted player 82. Deleted player pts. 8,378
  3. Avatar for stomjoh 83. stomjoh Lv 1 11 pts. 8,377
  4. Avatar for Incongruous 84. Incongruous Lv 1 11 pts. 8,363
  5. Avatar for tarimo 85. tarimo Lv 1 11 pts. 8,357
  6. Avatar for SKSbell 86. SKSbell Lv 1 10 pts. 8,347
  7. Avatar for SouperGenious 87. SouperGenious Lv 1 10 pts. 8,347
  8. Avatar for PepperRed 88. PepperRed Lv 1 10 pts. 8,344
  9. Avatar for altejoh 89. altejoh Lv 1 9 pts. 8,326
  10. Avatar for petetrig 90. petetrig Lv 1 9 pts. 8,319

Comments