Placeholder image of a protein
Icon representing a puzzle

1224: Unsolved De-novo Freestyle 78

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 25, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 8,917
  2. Avatar for Beta Folders 2. Beta Folders 81 pts. 8,905
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 64 pts. 8,876
  4. Avatar for Go Science 4. Go Science 50 pts. 8,861
  5. Avatar for Gargleblasters 5. Gargleblasters 39 pts. 8,852
  6. Avatar for HMT heritage 6. HMT heritage 30 pts. 8,798
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 23 pts. 8,762
  8. Avatar for Void Crushers 8. Void Crushers 17 pts. 8,757
  9. Avatar for D001x Med Chem MOOC 9. D001x Med Chem MOOC 12 pts. 8,755
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 9 pts. 8,493
  1. Avatar for YGK 81. YGK Lv 1 12 pts. 8,379
  2. Avatar for Deleted player 82. Deleted player pts. 8,378
  3. Avatar for stomjoh 83. stomjoh Lv 1 11 pts. 8,377
  4. Avatar for Incongruous 84. Incongruous Lv 1 11 pts. 8,363
  5. Avatar for tarimo 85. tarimo Lv 1 11 pts. 8,357
  6. Avatar for SKSbell 86. SKSbell Lv 1 10 pts. 8,347
  7. Avatar for SouperGenious 87. SouperGenious Lv 1 10 pts. 8,347
  8. Avatar for PepperRed 88. PepperRed Lv 1 10 pts. 8,344
  9. Avatar for altejoh 89. altejoh Lv 1 9 pts. 8,326
  10. Avatar for petetrig 90. petetrig Lv 1 9 pts. 8,319

Comments