Placeholder image of a protein
Icon representing a puzzle

1224: Unsolved De-novo Freestyle 78

Closed since almost 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
April 25, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA

Top groups



  1. Avatar for Bautho 101. Bautho Lv 1 6 pts. 8,240
  2. Avatar for kitek314_pl 102. kitek314_pl Lv 1 6 pts. 8,231
  3. Avatar for guineapig 103. guineapig Lv 1 6 pts. 8,228
  4. Avatar for Ernst Zundel 104. Ernst Zundel Lv 1 5 pts. 8,224
  5. Avatar for harvardman 105. harvardman Lv 1 5 pts. 8,218
  6. Avatar for Marvelz 106. Marvelz Lv 1 5 pts. 8,217
  7. Avatar for Arne Heessels 107. Arne Heessels Lv 1 5 pts. 8,205
  8. Avatar for Georgas 108. Georgas Lv 1 5 pts. 8,199
  9. Avatar for froggs554 109. froggs554 Lv 1 5 pts. 8,196
  10. Avatar for ratqueen03 110. ratqueen03 Lv 1 4 pts. 8,194

Comments