Placeholder image of a protein
Icon representing a puzzle

1224: Unsolved De-novo Freestyle 78

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 25, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA

Top groups



  1. Avatar for uihcv 111. uihcv Lv 1 4 pts. 8,173
  2. Avatar for Auntecedent 112. Auntecedent Lv 1 4 pts. 8,164
  3. Avatar for cinnamonkitty 113. cinnamonkitty Lv 1 4 pts. 8,161
  4. Avatar for arginia 114. arginia Lv 1 4 pts. 8,152
  5. Avatar for mitarcher 115. mitarcher Lv 1 4 pts. 8,128
  6. Avatar for YeshuaLives 116. YeshuaLives Lv 1 3 pts. 8,127
  7. Avatar for poiuyqwert 117. poiuyqwert Lv 1 3 pts. 8,124
  8. Avatar for Pro Lapser 118. Pro Lapser Lv 1 3 pts. 8,122
  9. Avatar for WarpSpeed 119. WarpSpeed Lv 1 3 pts. 8,117
  10. Avatar for BCAA 120. BCAA Lv 1 3 pts. 8,093

Comments