Placeholder image of a protein
Icon representing a puzzle

1224: Unsolved De-novo Freestyle 78

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 25, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA

Top groups



  1. Avatar for WBarme1234 121. WBarme1234 Lv 1 3 pts. 8,070
  2. Avatar for Tac1 122. Tac1 Lv 1 3 pts. 8,053
  3. Avatar for karost 123. karost Lv 1 3 pts. 8,053
  4. Avatar for ManVsYard 124. ManVsYard Lv 1 3 pts. 8,049
  5. Avatar for navn 125. navn Lv 1 2 pts. 8,045
  6. Avatar for Graham MF 126. Graham MF Lv 1 2 pts. 8,037
  7. Avatar for steveB 127. steveB Lv 1 2 pts. 8,035
  8. Avatar for placid.lion 128. placid.lion Lv 1 2 pts. 8,019
  9. Avatar for PrettyPony2001 129. PrettyPony2001 Lv 1 2 pts. 8,013
  10. Avatar for Qfast 130. Qfast Lv 1 2 pts. 8,008

Comments