Placeholder image of a protein
Icon representing a puzzle

1224: Unsolved De-novo Freestyle 78

Closed since almost 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
April 25, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA

Top groups

  1. Avatar for Medical Problem Solving II Home Page 21. Medical Problem Solving II Home Page 1 pt. 4,045
  2. Avatar for Penn State Biomolecular Engineers 22. Penn State Biomolecular Engineers 1 pt. 1,565
  3. Avatar for Richard Dawkins Foundation 23. Richard Dawkins Foundation 1 pt. 0
  4. Avatar for test_group1 24. test_group1 1 pt. 0
  1. Avatar for dbuske 131. dbuske Lv 1 2 pts. 7,990
  2. Avatar for jamiexq 132. jamiexq Lv 1 2 pts. 7,982
  3. Avatar for Festering Wounds 133. Festering Wounds Lv 1 2 pts. 7,968
  4. Avatar for demeter900 134. demeter900 Lv 1 2 pts. 7,951
  5. Avatar for ecali 135. ecali Lv 1 2 pts. 7,949
  6. Avatar for momadoc 136. momadoc Lv 1 2 pts. 7,928
  7. Avatar for parsnip 137. parsnip Lv 1 2 pts. 7,917
  8. Avatar for doctaven 138. doctaven Lv 1 2 pts. 7,914
  9. Avatar for Mydogisa Toelicker 139. Mydogisa Toelicker Lv 1 1 pt. 7,911
  10. Avatar for Mohambone 140. Mohambone Lv 1 1 pt. 7,904

Comments