Placeholder image of a protein
Icon representing a puzzle

1224: Unsolved De-novo Freestyle 78

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 25, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA

Top groups

  1. Avatar for Medical Problem Solving II Home Page 21. Medical Problem Solving II Home Page 1 pt. 4,045
  2. Avatar for Penn State Biomolecular Engineers 22. Penn State Biomolecular Engineers 1 pt. 1,565
  3. Avatar for Richard Dawkins Foundation 23. Richard Dawkins Foundation 1 pt. 0
  4. Avatar for test_group1 24. test_group1 1 pt. 0
  1. Avatar for anik 141. anik Lv 1 1 pt. 7,900
  2. Avatar for NameChangeNeeded01 142. NameChangeNeeded01 Lv 1 1 pt. 7,894
  3. Avatar for Iliya Dovganyuk 143. Iliya Dovganyuk Lv 1 1 pt. 7,890
  4. Avatar for smholst 144. smholst Lv 1 1 pt. 7,883
  5. Avatar for leomisso 145. leomisso Lv 1 1 pt. 7,872
  6. Avatar for boondog 146. boondog Lv 1 1 pt. 7,862
  7. Avatar for Tehnologik1 147. Tehnologik1 Lv 1 1 pt. 7,851
  8. Avatar for mirjamvandelft 148. mirjamvandelft Lv 1 1 pt. 7,850
  9. Avatar for eromana 149. eromana Lv 1 1 pt. 7,838
  10. Avatar for JohannesG 150. JohannesG Lv 1 1 pt. 7,831

Comments