Placeholder image of a protein
Icon representing a puzzle

1224: Unsolved De-novo Freestyle 78

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 25, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA

Top groups

  1. Avatar for Medical Problem Solving II Home Page 21. Medical Problem Solving II Home Page 1 pt. 4,045
  2. Avatar for Penn State Biomolecular Engineers 22. Penn State Biomolecular Engineers 1 pt. 1,565
  3. Avatar for Richard Dawkins Foundation 23. Richard Dawkins Foundation 1 pt. 0
  4. Avatar for test_group1 24. test_group1 1 pt. 0
  1. Avatar for martinf 161. martinf Lv 1 1 pt. 7,587
  2. Avatar for isantheautumn 162. isantheautumn Lv 1 1 pt. 7,575
  3. Avatar for mondetta77 163. mondetta77 Lv 1 1 pt. 7,572
  4. Avatar for chrismen3 164. chrismen3 Lv 1 1 pt. 7,559
  5. Avatar for RaeRae61 165. RaeRae61 Lv 1 1 pt. 7,539
  6. Avatar for landstraad 166. landstraad Lv 1 1 pt. 7,520
  7. Avatar for 01010011111 167. 01010011111 Lv 1 1 pt. 7,507
  8. Avatar for lamoille 168. lamoille Lv 1 1 pt. 7,465
  9. Avatar for tscarberry1 169. tscarberry1 Lv 1 1 pt. 7,461
  10. Avatar for Hollinas 170. Hollinas Lv 1 1 pt. 7,455

Comments