Placeholder image of a protein
Icon representing a puzzle

1224: Unsolved De-novo Freestyle 78

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 25, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA

Top groups

  1. Avatar for Medical Problem Solving II Home Page 21. Medical Problem Solving II Home Page 1 pt. 4,045
  2. Avatar for Penn State Biomolecular Engineers 22. Penn State Biomolecular Engineers 1 pt. 1,565
  3. Avatar for Richard Dawkins Foundation 23. Richard Dawkins Foundation 1 pt. 0
  4. Avatar for test_group1 24. test_group1 1 pt. 0
  1. Avatar for Jassiel 171. Jassiel Lv 1 1 pt. 7,454
  2. Avatar for Wheeler22 172. Wheeler22 Lv 1 1 pt. 7,413
  3. Avatar for pandapharmd 173. pandapharmd Lv 1 1 pt. 7,401
  4. Avatar for darkomega 174. darkomega Lv 1 1 pt. 7,365
  5. Avatar for kyuheonre1024 175. kyuheonre1024 Lv 1 1 pt. 7,342
  6. Avatar for Cerzax 176. Cerzax Lv 1 1 pt. 7,333
  7. Avatar for itboswelll 177. itboswelll Lv 1 1 pt. 7,309
  8. Avatar for HMK 178. HMK Lv 1 1 pt. 7,245
  9. Avatar for mathhacker 179. mathhacker Lv 1 1 pt. 7,233
  10. Avatar for Fowardint 180. Fowardint Lv 1 1 pt. 7,163

Comments