Placeholder image of a protein
Icon representing a puzzle

1224: Unsolved De-novo Freestyle 78

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 25, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA

Top groups

  1. Avatar for Medical Problem Solving II Home Page 21. Medical Problem Solving II Home Page 1 pt. 4,045
  2. Avatar for Penn State Biomolecular Engineers 22. Penn State Biomolecular Engineers 1 pt. 1,565
  3. Avatar for Richard Dawkins Foundation 23. Richard Dawkins Foundation 1 pt. 0
  4. Avatar for test_group1 24. test_group1 1 pt. 0
  1. Avatar for DScott 181. DScott Lv 1 1 pt. 7,152
  2. Avatar for Stephen R 182. Stephen R Lv 1 1 pt. 7,127
  3. Avatar for Tlaloc 183. Tlaloc Lv 1 1 pt. 7,125
  4. Avatar for Andrei Enoae 184. Andrei Enoae Lv 1 1 pt. 7,122
  5. Avatar for ace2787 185. ace2787 Lv 1 1 pt. 7,080
  6. Avatar for Zuhayr 186. Zuhayr Lv 1 1 pt. 7,069
  7. Avatar for Samuelson_B_SAU319 187. Samuelson_B_SAU319 Lv 1 1 pt. 7,035
  8. Avatar for Truncheon Luncheon 188. Truncheon Luncheon Lv 1 1 pt. 6,956
  9. Avatar for stalluri 189. stalluri Lv 1 1 pt. 6,872
  10. Avatar for Mr_Jolty 190. Mr_Jolty Lv 1 1 pt. 6,785

Comments