Placeholder image of a protein
Icon representing a puzzle

1224: Unsolved De-novo Freestyle 78

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 25, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA

Top groups



  1. Avatar for Blipperman 11. Blipperman Lv 1 80 pts. 8,852
  2. Avatar for Bruno Kestemont 12. Bruno Kestemont Lv 1 79 pts. 8,852
  3. Avatar for mirp 13. mirp Lv 1 77 pts. 8,840
  4. Avatar for dembones 14. dembones Lv 1 75 pts. 8,839
  5. Avatar for actiasluna 15. actiasluna Lv 1 73 pts. 8,837
  6. Avatar for spvincent 16. spvincent Lv 1 72 pts. 8,826
  7. Avatar for pauldunn 17. pauldunn Lv 1 70 pts. 8,807
  8. Avatar for fishercat 18. fishercat Lv 1 68 pts. 8,802
  9. Avatar for O Seki To 19. O Seki To Lv 1 67 pts. 8,798
  10. Avatar for Susume 20. Susume Lv 1 65 pts. 8,794

Comments