Placeholder image of a protein
Icon representing a puzzle

1224: Unsolved De-novo Freestyle 78

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 25, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA

Top groups



  1. Avatar for Flagg65a 191. Flagg65a Lv 1 1 pt. 6,670
  2. Avatar for strbac.i.ltcc 192. strbac.i.ltcc Lv 1 1 pt. 5,787
  3. Avatar for azak2002 193. azak2002 Lv 1 1 pt. 5,782
  4. Avatar for kalachastan 194. kalachastan Lv 1 1 pt. 5,739
  5. Avatar for SilentET 195. SilentET Lv 1 1 pt. 5,475
  6. Avatar for larry25427 196. larry25427 Lv 1 1 pt. 5,300
  7. Avatar for penteplayer 197. penteplayer Lv 1 1 pt. 5,187
  8. Avatar for Mormal 198. Mormal Lv 1 1 pt. 4,964
  9. Avatar for SadertdinovRamazan 199. SadertdinovRamazan Lv 1 1 pt. 4,902
  10. Avatar for redstorm45 200. redstorm45 Lv 1 1 pt. 4,820

Comments