Placeholder image of a protein
Icon representing a puzzle

1224: Unsolved De-novo Freestyle 78

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 25, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA

Top groups

  1. Avatar for Medical Problem Solving II Home Page 21. Medical Problem Solving II Home Page 1 pt. 4,045
  2. Avatar for Penn State Biomolecular Engineers 22. Penn State Biomolecular Engineers 1 pt. 1,565
  3. Avatar for Richard Dawkins Foundation 23. Richard Dawkins Foundation 1 pt. 0
  4. Avatar for test_group1 24. test_group1 1 pt. 0
  1. Avatar for rbingham 211. rbingham Lv 1 1 pt. 4,045
  2. Avatar for thrakar9 212. thrakar9 Lv 1 1 pt. 3,671
  3. Avatar for ponfe22 213. ponfe22 Lv 1 1 pt. 3,304
  4. Avatar for p1639hj 214. p1639hj Lv 1 1 pt. 2,881
  5. Avatar for azzencrusher 215. azzencrusher Lv 1 1 pt. 2,393
  6. Avatar for JeanBoston 216. JeanBoston Lv 1 1 pt. 2,127
  7. Avatar for CONKY 217. CONKY Lv 1 1 pt. 1,594
  8. Avatar for cif5159 218. cif5159 Lv 1 1 pt. 1,565
  9. Avatar for Colostomy EXPLOSION. 219. Colostomy EXPLOSION. Lv 1 1 pt. 0
  10. Avatar for Deleted player 220. Deleted player 1 pt. 0

Comments