Placeholder image of a protein
Icon representing a puzzle

1224: Unsolved De-novo Freestyle 78

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 25, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA

Top groups

  1. Avatar for Medical Problem Solving II Home Page 21. Medical Problem Solving II Home Page 1 pt. 4,045
  2. Avatar for Penn State Biomolecular Engineers 22. Penn State Biomolecular Engineers 1 pt. 1,565
  3. Avatar for Richard Dawkins Foundation 23. Richard Dawkins Foundation 1 pt. 0
  4. Avatar for test_group1 24. test_group1 1 pt. 0
  1. Avatar for watascifi 221. watascifi Lv 1 1 pt. 0
  2. Avatar for test_account1 222. test_account1 Lv 1 1 pt. 0
  3. Avatar for packer 223. packer Lv 1 1 pt. 0
  4. Avatar for bkoep 224. bkoep Lv 1 1 pt. 0
  5. Avatar for Idiotboy 225. Idiotboy Lv 1 1 pt. 0
  6. Avatar for decbin 226. decbin Lv 1 1 pt. 0
  7. Avatar for leehaggis 227. leehaggis Lv 1 1 pt. 0
  8. Avatar for dak3910 228. dak3910 Lv 1 1 pt. 0
  9. Avatar for zkm 229. zkm Lv 1 1 pt. 0

Comments