Placeholder image of a protein
Icon representing a puzzle

1224: Unsolved De-novo Freestyle 78

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 25, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA

Top groups

  1. Avatar for Medical Problem Solving II Home Page 21. Medical Problem Solving II Home Page 1 pt. 4,045
  2. Avatar for Penn State Biomolecular Engineers 22. Penn State Biomolecular Engineers 1 pt. 1,565
  3. Avatar for Richard Dawkins Foundation 23. Richard Dawkins Foundation 1 pt. 0
  4. Avatar for test_group1 24. test_group1 1 pt. 0
  1. Avatar for dcrwheeler 21. dcrwheeler Lv 1 64 pts. 8,790
  2. Avatar for tallguy-13088 22. tallguy-13088 Lv 1 62 pts. 8,782
  3. Avatar for alcor29 23. alcor29 Lv 1 61 pts. 8,781
  4. Avatar for KarenCH 24. KarenCH Lv 1 59 pts. 8,774
  5. Avatar for christioanchauvin 25. christioanchauvin Lv 1 58 pts. 8,762
  6. Avatar for Timo van der Laan 26. Timo van der Laan Lv 1 56 pts. 8,757
  7. Avatar for D001x_ErlandStevens 27. D001x_ErlandStevens Lv 1 55 pts. 8,755
  8. Avatar for gmn 28. gmn Lv 1 54 pts. 8,746
  9. Avatar for Scopper 29. Scopper Lv 1 52 pts. 8,743
  10. Avatar for reefyrob 30. reefyrob Lv 1 51 pts. 8,742

Comments