Placeholder image of a protein
Icon representing a puzzle

1224: Unsolved De-novo Freestyle 78

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 25, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA

Top groups



  1. Avatar for Glen B 31. Glen B Lv 1 50 pts. 8,738
  2. Avatar for isaksson 32. isaksson Lv 1 49 pts. 8,731
  3. Avatar for SamuelJackson 33. SamuelJackson Lv 1 47 pts. 8,724
  4. Avatar for frood66 34. frood66 Lv 1 46 pts. 8,707
  5. Avatar for lynnai 35. lynnai Lv 1 45 pts. 8,697
  6. Avatar for johnmitch 36. johnmitch Lv 1 44 pts. 8,686
  7. Avatar for nicobul 37. nicobul Lv 1 43 pts. 8,686
  8. Avatar for grogar7 38. grogar7 Lv 1 42 pts. 8,685
  9. Avatar for Anfinsen_slept_here 40. Anfinsen_slept_here Lv 1 40 pts. 8,666

Comments