Placeholder image of a protein
Icon representing a puzzle

1224: Unsolved De-novo Freestyle 78

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 25, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA

Top groups

  1. Avatar for Medical Problem Solving II Home Page 21. Medical Problem Solving II Home Page 1 pt. 4,045
  2. Avatar for Penn State Biomolecular Engineers 22. Penn State Biomolecular Engineers 1 pt. 1,565
  3. Avatar for Richard Dawkins Foundation 23. Richard Dawkins Foundation 1 pt. 0
  4. Avatar for test_group1 24. test_group1 1 pt. 0
  1. Avatar for Origami314 41. Origami314 Lv 1 39 pts. 8,664
  2. Avatar for yoyoparis 42. yoyoparis Lv 1 38 pts. 8,659
  3. Avatar for Deleted player 43. Deleted player pts. 8,653
  4. Avatar for TomTaylor 44. TomTaylor Lv 1 36 pts. 8,645
  5. Avatar for alwen 45. alwen Lv 1 35 pts. 8,629
  6. Avatar for pmdpmd 46. pmdpmd Lv 1 34 pts. 8,624
  7. Avatar for nemo7731 47. nemo7731 Lv 1 33 pts. 8,623
  8. Avatar for weitzen 48. weitzen Lv 1 32 pts. 8,617
  9. Avatar for g_b 49. g_b Lv 1 31 pts. 8,612
  10. Avatar for caglar 50. caglar Lv 1 30 pts. 8,590

Comments