Placeholder image of a protein
Icon representing a puzzle

1224: Unsolved De-novo Freestyle 78

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 25, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA

Top groups

  1. Avatar for Medical Problem Solving II Home Page 21. Medical Problem Solving II Home Page 1 pt. 4,045
  2. Avatar for Penn State Biomolecular Engineers 22. Penn State Biomolecular Engineers 1 pt. 1,565
  3. Avatar for Richard Dawkins Foundation 23. Richard Dawkins Foundation 1 pt. 0
  4. Avatar for test_group1 24. test_group1 1 pt. 0
  1. Avatar for jobo0502 51. jobo0502 Lv 1 30 pts. 8,585
  2. Avatar for hansvandenhof 52. hansvandenhof Lv 1 29 pts. 8,570
  3. Avatar for TastyMunchies 53. TastyMunchies Lv 1 28 pts. 8,563
  4. Avatar for manu8170 54. manu8170 Lv 1 27 pts. 8,562
  5. Avatar for NinjaGreg 55. NinjaGreg Lv 1 26 pts. 8,562
  6. Avatar for smilingone 56. smilingone Lv 1 26 pts. 8,556
  7. Avatar for diamonddays 57. diamonddays Lv 1 25 pts. 8,545
  8. Avatar for Satina 58. Satina Lv 1 24 pts. 8,542
  9. Avatar for Mike Lewis 59. Mike Lewis Lv 1 24 pts. 8,531
  10. Avatar for joremen 60. joremen Lv 1 23 pts. 8,528

Comments