Placeholder image of a protein
Icon representing a puzzle

1224: Unsolved De-novo Freestyle 78

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 25, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA

Top groups



  1. Avatar for cbwest 61. cbwest Lv 1 22 pts. 8,515
  2. Avatar for Bletchley Park 62. Bletchley Park Lv 1 22 pts. 8,512
  3. Avatar for Museka 63. Museka Lv 1 21 pts. 8,512
  4. Avatar for Superphosphate 64. Superphosphate Lv 1 20 pts. 8,509
  5. Avatar for Jim Fraser 65. Jim Fraser Lv 1 20 pts. 8,503
  6. Avatar for jermainiac 66. jermainiac Lv 1 19 pts. 8,500
  7. Avatar for Bushman 67. Bushman Lv 1 19 pts. 8,493
  8. Avatar for drumpeter18yrs9yrs 68. drumpeter18yrs9yrs Lv 1 18 pts. 8,489
  9. Avatar for deLaCeiba 69. deLaCeiba Lv 1 18 pts. 8,486
  10. Avatar for pvc78 70. pvc78 Lv 1 17 pts. 8,474

Comments