Placeholder image of a protein
Icon representing a puzzle

1224: Unsolved De-novo Freestyle 78

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 25, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA

Top groups

  1. Avatar for Medical Problem Solving II Home Page 21. Medical Problem Solving II Home Page 1 pt. 4,045
  2. Avatar for Penn State Biomolecular Engineers 22. Penn State Biomolecular Engineers 1 pt. 1,565
  3. Avatar for Richard Dawkins Foundation 23. Richard Dawkins Foundation 1 pt. 0
  4. Avatar for test_group1 24. test_group1 1 pt. 0
  1. Avatar for andrewxc 71. andrewxc Lv 1 16 pts. 8,433
  2. Avatar for JMStiffler 72. JMStiffler Lv 1 16 pts. 8,408
  3. Avatar for crpainter 73. crpainter Lv 1 15 pts. 8,408
  4. Avatar for Punktchen 74. Punktchen Lv 1 15 pts. 8,407
  5. Avatar for JUMELLE54 75. JUMELLE54 Lv 1 15 pts. 8,405
  6. Avatar for bx7gn 76. bx7gn Lv 1 14 pts. 8,401
  7. Avatar for Crossed Sticks 77. Crossed Sticks Lv 1 14 pts. 8,397
  8. Avatar for pfirth 78. pfirth Lv 1 13 pts. 8,396
  9. Avatar for Merf 79. Merf Lv 1 13 pts. 8,393
  10. Avatar for Vinara 80. Vinara Lv 1 12 pts. 8,386

Comments