Placeholder image of a protein
Icon representing a puzzle

1224: Unsolved De-novo Freestyle 78

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 25, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA

Top groups


  1. Avatar for Contenders 100 pts. 8,917
  2. Avatar for Beta Folders 2. Beta Folders 81 pts. 8,905
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 64 pts. 8,876
  4. Avatar for Go Science 4. Go Science 50 pts. 8,861
  5. Avatar for Gargleblasters 5. Gargleblasters 39 pts. 8,852
  6. Avatar for HMT heritage 6. HMT heritage 30 pts. 8,798
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 23 pts. 8,762
  8. Avatar for Void Crushers 8. Void Crushers 17 pts. 8,757
  9. Avatar for D001x Med Chem MOOC 9. D001x Med Chem MOOC 12 pts. 8,755
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 9 pts. 8,493

  1. Avatar for Mike Cassidy 91. Mike Cassidy Lv 1 9 pts. 8,313
  2. Avatar for bendbob 92. bendbob Lv 1 8 pts. 8,312
  3. Avatar for DodoBird 93. DodoBird Lv 1 8 pts. 8,296
  4. Avatar for justjustin 94. justjustin Lv 1 8 pts. 8,296
  5. Avatar for gurch 95. gurch Lv 1 8 pts. 8,295
  6. Avatar for me357 96. me357 Lv 1 7 pts. 8,279
  7. Avatar for t012 97. t012 Lv 1 7 pts. 8,269
  8. Avatar for rinze 98. rinze Lv 1 7 pts. 8,248
  9. Avatar for hada 99. hada Lv 1 7 pts. 8,246
  10. Avatar for ViJay7019 100. ViJay7019 Lv 1 6 pts. 8,242

Comments