Placeholder image of a protein
Icon representing a puzzle

1225: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,965
  2. Avatar for Gargleblasters 2. Gargleblasters 80 pts. 9,897
  3. Avatar for Go Science 3. Go Science 63 pts. 9,870
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 49 pts. 9,850
  5. Avatar for Contenders 5. Contenders 37 pts. 9,831
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 28 pts. 9,799
  7. Avatar for Void Crushers 7. Void Crushers 21 pts. 9,788
  8. Avatar for D001x Med Chem MOOC 8. D001x Med Chem MOOC 15 pts. 9,784
  9. Avatar for HMT heritage 9. HMT heritage 11 pts. 9,768
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 8 pts. 9,704
  1. Avatar for harvardman 121. harvardman Lv 1 2 pts. 9,552
  2. Avatar for pandapharmd 122. pandapharmd Lv 1 2 pts. 9,550
  3. Avatar for steveB 123. steveB Lv 1 2 pts. 9,550
  4. Avatar for Soggy Doglog 124. Soggy Doglog Lv 1 2 pts. 9,549
  5. Avatar for pfirth 125. pfirth Lv 1 2 pts. 9,547
  6. Avatar for Mohambone 126. Mohambone Lv 1 2 pts. 9,543
  7. Avatar for cbwest 127. cbwest Lv 1 2 pts. 9,542
  8. Avatar for NameChangeNeeded01 128. NameChangeNeeded01 Lv 1 2 pts. 9,532
  9. Avatar for tela 129. tela Lv 1 2 pts. 9,523
  10. Avatar for Mydogisa Toelicker 130. Mydogisa Toelicker Lv 1 2 pts. 9,515

Comments