Placeholder image of a protein
Icon representing a puzzle

1225: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,965
  2. Avatar for Gargleblasters 2. Gargleblasters 80 pts. 9,897
  3. Avatar for Go Science 3. Go Science 63 pts. 9,870
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 49 pts. 9,850
  5. Avatar for Contenders 5. Contenders 37 pts. 9,831
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 28 pts. 9,799
  7. Avatar for Void Crushers 7. Void Crushers 21 pts. 9,788
  8. Avatar for D001x Med Chem MOOC 8. D001x Med Chem MOOC 15 pts. 9,784
  9. Avatar for HMT heritage 9. HMT heritage 11 pts. 9,768
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 8 pts. 9,704
  1. Avatar for eromana 81. eromana Lv 1 11 pts. 9,652
  2. Avatar for kitek314_pl 82. kitek314_pl Lv 1 10 pts. 9,651
  3. Avatar for Crossed Sticks 83. Crossed Sticks Lv 1 10 pts. 9,648
  4. Avatar for Merf 84. Merf Lv 1 10 pts. 9,648
  5. Avatar for sheerbliss 85. sheerbliss Lv 1 9 pts. 9,646
  6. Avatar for isaksson 86. isaksson Lv 1 9 pts. 9,644
  7. Avatar for hansvandenhof 87. hansvandenhof Lv 1 9 pts. 9,640
  8. Avatar for froggs554 88. froggs554 Lv 1 8 pts. 9,640
  9. Avatar for Deleted player 89. Deleted player pts. 9,637
  10. Avatar for alwen 90. alwen Lv 1 8 pts. 9,636

Comments