Placeholder image of a protein
Icon representing a puzzle

1227: Unsolved De-novo Freestyle 78: Predicted Contacts

Closed since almost 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
May 02, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1224, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1224 and use them as a starting point here.



Sequence:


VAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIVETKVEEEVQRISRGRGA

Top groups


  1. Avatar for Russian team 11. Russian team 5 pts. 9,642
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 4 pts. 9,556
  3. Avatar for It's over 9000! 13. It's over 9000! 2 pts. 9,185
  4. Avatar for Natural Abilities 14. Natural Abilities 2 pts. 8,844
  5. Avatar for Team South Africa 15. Team South Africa 1 pt. 8,746
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 8,695
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 8,402
  8. Avatar for xkcd 18. xkcd 1 pt. 7,740
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 4,602
  10. Avatar for Deleted group 20. Deleted group pts. 2,448

  1. Avatar for Scopper 51. Scopper Lv 1 27 pts. 9,788
  2. Avatar for martin.szew 52. martin.szew Lv 1 26 pts. 9,788
  3. Avatar for pmdpmd 53. pmdpmd Lv 1 25 pts. 9,781
  4. Avatar for cbwest 54. cbwest Lv 1 24 pts. 9,769
  5. Avatar for Merf 55. Merf Lv 1 23 pts. 9,766
  6. Avatar for smilingone 56. smilingone Lv 1 23 pts. 9,763
  7. Avatar for diamond_dust 57. diamond_dust Lv 1 22 pts. 9,759
  8. Avatar for SKSbell 58. SKSbell Lv 1 21 pts. 9,753
  9. Avatar for caglar 59. caglar Lv 1 21 pts. 9,750
  10. Avatar for Punktchen 60. Punktchen Lv 1 20 pts. 9,749

Comments