Placeholder image of a protein
Icon representing a puzzle

1228: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
May 04, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,193
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 10,094
  3. Avatar for Contenders 3. Contenders 52 pts. 10,056
  4. Avatar for Go Science 4. Go Science 36 pts. 10,032
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 9,973
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 9,925
  7. Avatar for HMT heritage 7. HMT heritage 10 pts. 9,879
  8. Avatar for D001x Med Chem MOOC 8. D001x Med Chem MOOC 6 pts. 9,870
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 4 pts. 9,837
  10. Avatar for It's over 9000! 10. It's over 9000! 2 pts. 9,649
  1. Avatar for Fetztastic 121. Fetztastic Lv 1 1 pt. 9,325
  2. Avatar for DodoBird 122. DodoBird Lv 1 1 pt. 9,321
  3. Avatar for freethought78 123. freethought78 Lv 1 1 pt. 9,312
  4. Avatar for martinf 124. martinf Lv 1 1 pt. 9,312
  5. Avatar for GenGF 125. GenGF Lv 1 1 pt. 9,280
  6. Avatar for Auntecedent 126. Auntecedent Lv 1 1 pt. 9,279
  7. Avatar for fryguy 127. fryguy Lv 1 1 pt. 9,274
  8. Avatar for ViJay7019 128. ViJay7019 Lv 1 1 pt. 9,236
  9. Avatar for ChinaSESsolve 129. ChinaSESsolve Lv 1 1 pt. 9,234
  10. Avatar for hada 130. hada Lv 1 1 pt. 9,227

Comments