Placeholder image of a protein
Icon representing a puzzle

1228: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
May 04, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,193
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 10,094
  3. Avatar for Contenders 3. Contenders 52 pts. 10,056
  4. Avatar for Go Science 4. Go Science 36 pts. 10,032
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 9,973
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 9,925
  7. Avatar for HMT heritage 7. HMT heritage 10 pts. 9,879
  8. Avatar for D001x Med Chem MOOC 8. D001x Med Chem MOOC 6 pts. 9,870
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 4 pts. 9,837
  10. Avatar for It's over 9000! 10. It's over 9000! 2 pts. 9,649
  1. Avatar for johngran 81. johngran Lv 1 7 pts. 9,504
  2. Avatar for diamond_dust 82. diamond_dust Lv 1 7 pts. 9,496
  3. Avatar for Tehnologik1 83. Tehnologik1 Lv 1 7 pts. 9,469
  4. Avatar for pfirth 84. pfirth Lv 1 6 pts. 9,464
  5. Avatar for phi16 85. phi16 Lv 1 6 pts. 9,464
  6. Avatar for Superphosphate 86. Superphosphate Lv 1 6 pts. 9,464
  7. Avatar for Merf 87. Merf Lv 1 6 pts. 9,462
  8. Avatar for decbin 88. decbin Lv 1 5 pts. 9,462
  9. Avatar for Giant Berk 89. Giant Berk Lv 1 5 pts. 9,460
  10. Avatar for SouperGenious 90. SouperGenious Lv 1 5 pts. 9,449

Comments