Placeholder image of a protein
Icon representing a puzzle

1228: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 04, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups


  1. Avatar for Beta Folders 100 pts. 10,193
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 10,094
  3. Avatar for Contenders 3. Contenders 52 pts. 10,056
  4. Avatar for Go Science 4. Go Science 36 pts. 10,032
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 9,973
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 9,925
  7. Avatar for HMT heritage 7. HMT heritage 10 pts. 9,879
  8. Avatar for D001x Med Chem MOOC 8. D001x Med Chem MOOC 6 pts. 9,870
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 4 pts. 9,837
  10. Avatar for It's over 9000! 10. It's over 9000! 2 pts. 9,649

  1. Avatar for nicobul 31. nicobul Lv 1 43 pts. 9,837
  2. Avatar for fiendish_ghoul 32. fiendish_ghoul Lv 1 42 pts. 9,836
  3. Avatar for TomTaylor 33. TomTaylor Lv 1 40 pts. 9,833
  4. Avatar for Norrjane 34. Norrjane Lv 1 39 pts. 9,814
  5. Avatar for g_b 35. g_b Lv 1 38 pts. 9,805
  6. Avatar for frood66 36. frood66 Lv 1 37 pts. 9,804
  7. Avatar for dcrwheeler 37. dcrwheeler Lv 1 36 pts. 9,792
  8. Avatar for pmdpmd 38. pmdpmd Lv 1 35 pts. 9,787
  9. Avatar for jermainiac 39. jermainiac Lv 1 33 pts. 9,773
  10. Avatar for diamonddays 40. diamonddays Lv 1 32 pts. 9,770

Comments