Placeholder image of a protein
Icon representing a puzzle

1228: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
May 04, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,193
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 10,094
  3. Avatar for Contenders 3. Contenders 52 pts. 10,056
  4. Avatar for Go Science 4. Go Science 36 pts. 10,032
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 9,973
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 9,925
  7. Avatar for HMT heritage 7. HMT heritage 10 pts. 9,879
  8. Avatar for D001x Med Chem MOOC 8. D001x Med Chem MOOC 6 pts. 9,870
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 4 pts. 9,837
  10. Avatar for It's over 9000! 10. It's over 9000! 2 pts. 9,649
  1. Avatar for Marvelz 51. Marvelz Lv 1 22 pts. 9,708
  2. Avatar for tarimo 52. tarimo Lv 1 22 pts. 9,707
  3. Avatar for Graham MF 53. Graham MF Lv 1 21 pts. 9,693
  4. Avatar for cherry39 54. cherry39 Lv 1 20 pts. 9,690
  5. Avatar for altejoh 55. altejoh Lv 1 19 pts. 9,686
  6. Avatar for caglar 56. caglar Lv 1 19 pts. 9,682
  7. Avatar for isaksson 57. isaksson Lv 1 18 pts. 9,679
  8. Avatar for alwen 58. alwen Lv 1 17 pts. 9,672
  9. Avatar for tallguy-13088 59. tallguy-13088 Lv 1 17 pts. 9,672
  10. Avatar for stomjoh 60. stomjoh Lv 1 16 pts. 9,667

Comments