Placeholder image of a protein
Icon representing a puzzle

1231: Unsolved De-novo Freestyle 79

Closed since almost 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 10, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MDAPASFSLGAMGPLLRKLDSLLVAPEIRLPKPLKEGIELLKEDLEEIGVSLVEHSVVDSPTHKARFWMDEVRDLSYHIEDCIDTMFSMRSGGDDGKPRSERRHKVGRAKIDGFSKKPKPCTRMARIAELRALVREASERLERYQLGDVCGSSS

Top groups


  1. Avatar for D001x Med Chem MOOC 11. D001x Med Chem MOOC 2 pts. 8,437
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 8,373
  3. Avatar for Deleted group 13. Deleted group pts. 8,191
  4. Avatar for CHNO Junkies 14. CHNO Junkies 1 pt. 8,173
  5. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 8,136
  6. Avatar for xkcd 16. xkcd 1 pt. 7,872
  7. Avatar for KaosKorp 17. KaosKorp 1 pt. 7,445
  8. Avatar for TheBirds 18. TheBirds 1 pt. 3,800
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 0

  1. Avatar for TomTaylor
    1. TomTaylor Lv 1
    100 pts. 9,805
  2. Avatar for Bletchley Park 2. Bletchley Park Lv 1 86 pts. 9,783
  3. Avatar for smilingone 3. smilingone Lv 1 73 pts. 9,764
  4. Avatar for LociOiling 4. LociOiling Lv 1 62 pts. 9,762
  5. Avatar for gitwut 5. gitwut Lv 1 52 pts. 9,760
  6. Avatar for reefyrob 6. reefyrob Lv 1 43 pts. 9,756
  7. Avatar for bertro 7. bertro Lv 1 36 pts. 9,755
  8. Avatar for retiredmichael 8. retiredmichael Lv 1 30 pts. 9,748
  9. Avatar for Deleted player 9. Deleted player pts. 9,728
  10. Avatar for Scopper 10. Scopper Lv 1 20 pts. 9,720

Comments