1231: Unsolved De-novo Freestyle 79
Closed since almost 10 years ago
Intermediate Intermediate Intermediate Overall Overall Overall Prediction Prediction PredictionSummary
- Created
- May 10, 2016
- Expires
- Max points
- 100
The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!
Sequence:
MDAPASFSLGAMGPLLRKLDSLLVAPEIRLPKPLKEGIELLKEDLEEIGVSLVEHSVVDSPTHKARFWMDEVRDLSYHIEDCIDTMFSMRSGGDDGKPRSERRHKVGRAKIDGFSKKPKPCTRMARIAELRALVREASERLERYQLGDVCGSSS