Placeholder image of a protein
Icon representing a puzzle

1231: Unsolved De-novo Freestyle 79

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
May 10, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MDAPASFSLGAMGPLLRKLDSLLVAPEIRLPKPLKEGIELLKEDLEEIGVSLVEHSVVDSPTHKARFWMDEVRDLSYHIEDCIDTMFSMRSGGDDGKPRSERRHKVGRAKIDGFSKKPKPCTRMARIAELRALVREASERLERYQLGDVCGSSS

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,805
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,764
  3. Avatar for Go Science 3. Go Science 56 pts. 9,720
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 9,701
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 9,642
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 9,584
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 9,398
  8. Avatar for Deleted group 8. Deleted group pts. 9,360
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 9,021
  10. Avatar for BOINC@Poland 10. BOINC@Poland 4 pts. 8,702
  1. Avatar for gloverd 11. gloverd Lv 1 16 pts. 9,720
  2. Avatar for jeff101 12. jeff101 Lv 1 13 pts. 9,720
  3. Avatar for Bruno Kestemont 13. Bruno Kestemont Lv 1 10 pts. 9,720
  4. Avatar for mirp 14. mirp Lv 1 8 pts. 9,719
  5. Avatar for DodoBird 15. DodoBird Lv 1 6 pts. 9,714
  6. Avatar for Galaxie 16. Galaxie Lv 1 5 pts. 9,701
  7. Avatar for lamoille 17. lamoille Lv 1 4 pts. 9,691
  8. Avatar for alwen 18. alwen Lv 1 3 pts. 9,678
  9. Avatar for alcor29 19. alcor29 Lv 1 2 pts. 9,675
  10. Avatar for mimi 20. mimi Lv 1 2 pts. 9,669

Comments