Placeholder image of a protein
Icon representing a puzzle

1231: Unsolved De-novo Freestyle 79

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 10, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MDAPASFSLGAMGPLLRKLDSLLVAPEIRLPKPLKEGIELLKEDLEEIGVSLVEHSVVDSPTHKARFWMDEVRDLSYHIEDCIDTMFSMRSGGDDGKPRSERRHKVGRAKIDGFSKKPKPCTRMARIAELRALVREASERLERYQLGDVCGSSS

Top groups


  1. Avatar for Contenders 100 pts. 9,805
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,764
  3. Avatar for Go Science 3. Go Science 56 pts. 9,720
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 9,701
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 9,642
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 9,584
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 9,398
  8. Avatar for Deleted group 8. Deleted group pts. 9,360
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 9,021
  10. Avatar for BOINC@Poland 10. BOINC@Poland 4 pts. 8,702

  1. Avatar for ViJay7019 101. ViJay7019 Lv 1 4 pts. 8,184
  2. Avatar for pmlkjn 102. pmlkjn Lv 1 4 pts. 8,173
  3. Avatar for DodoBird 103. DodoBird Lv 1 4 pts. 8,142
  4. Avatar for YGK 104. YGK Lv 1 3 pts. 8,138
  5. Avatar for deLaCeiba 105. deLaCeiba Lv 1 3 pts. 8,136
  6. Avatar for hada 106. hada Lv 1 3 pts. 8,131
  7. Avatar for JUMELLE54 107. JUMELLE54 Lv 1 3 pts. 8,110
  8. Avatar for froggs554 108. froggs554 Lv 1 3 pts. 8,098
  9. Avatar for hansvandenhof 109. hansvandenhof Lv 1 3 pts. 8,088
  10. Avatar for mirjamvandelft 110. mirjamvandelft Lv 1 3 pts. 8,083

Comments