Placeholder image of a protein
Icon representing a puzzle

1231: Unsolved De-novo Freestyle 79

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 10, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MDAPASFSLGAMGPLLRKLDSLLVAPEIRLPKPLKEGIELLKEDLEEIGVSLVEHSVVDSPTHKARFWMDEVRDLSYHIEDCIDTMFSMRSGGDDGKPRSERRHKVGRAKIDGFSKKPKPCTRMARIAELRALVREASERLERYQLGDVCGSSS

Top groups


  1. Avatar for Contenders 100 pts. 9,805
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,764
  3. Avatar for Go Science 3. Go Science 56 pts. 9,720
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 9,701
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 9,642
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 9,584
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 9,398
  8. Avatar for Deleted group 8. Deleted group pts. 9,360
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 9,021
  10. Avatar for BOINC@Poland 10. BOINC@Poland 4 pts. 8,702

  1. Avatar for Anfinsen_slept_here 31. Anfinsen_slept_here Lv 1 46 pts. 9,365
  2. Avatar for drumpeter18yrs9yrs 32. drumpeter18yrs9yrs Lv 1 44 pts. 9,360
  3. Avatar for nicobul 33. nicobul Lv 1 43 pts. 9,352
  4. Avatar for gitwut 34. gitwut Lv 1 42 pts. 9,325
  5. Avatar for alcor29 35. alcor29 Lv 1 41 pts. 9,278
  6. Avatar for reefyrob 36. reefyrob Lv 1 40 pts. 9,251
  7. Avatar for dembones 37. dembones Lv 1 38 pts. 9,238
  8. Avatar for andrewxc 38. andrewxc Lv 1 37 pts. 9,213
  9. Avatar for Fetztastic 39. Fetztastic Lv 1 36 pts. 9,203
  10. Avatar for Madde 40. Madde Lv 1 35 pts. 9,201

Comments