Placeholder image of a protein
Icon representing a puzzle

1231: Unsolved De-novo Freestyle 79

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 10, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MDAPASFSLGAMGPLLRKLDSLLVAPEIRLPKPLKEGIELLKEDLEEIGVSLVEHSVVDSPTHKARFWMDEVRDLSYHIEDCIDTMFSMRSGGDDGKPRSERRHKVGRAKIDGFSKKPKPCTRMARIAELRALVREASERLERYQLGDVCGSSS

Top groups


  1. Avatar for Contenders 100 pts. 9,805
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,764
  3. Avatar for Go Science 3. Go Science 56 pts. 9,720
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 9,701
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 9,642
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 9,584
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 9,398
  8. Avatar for Deleted group 8. Deleted group pts. 9,360
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 9,021
  10. Avatar for BOINC@Poland 10. BOINC@Poland 4 pts. 8,702

  1. Avatar for yoyoparis 81. yoyoparis Lv 1 9 pts. 8,588
  2. Avatar for manu8170 82. manu8170 Lv 1 8 pts. 8,586
  3. Avatar for jobo0502 83. jobo0502 Lv 1 8 pts. 8,556
  4. Avatar for Superphosphate 84. Superphosphate Lv 1 8 pts. 8,524
  5. Avatar for SKSbell 85. SKSbell Lv 1 8 pts. 8,520
  6. Avatar for ecali 86. ecali Lv 1 7 pts. 8,482
  7. Avatar for Graham MF 87. Graham MF Lv 1 7 pts. 8,478
  8. Avatar for ManVsYard 88. ManVsYard Lv 1 7 pts. 8,440
  9. Avatar for SouperGenious 90. SouperGenious Lv 1 6 pts. 8,434

Comments