Placeholder image of a protein
Icon representing a puzzle

1232: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since almost 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 11, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,489
  2. Avatar for xkcd 12. xkcd 1 pt. 9,484
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 9,460
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 9,405
  5. Avatar for Freedom Folders 15. Freedom Folders 1 pt. 9,374
  6. Avatar for CHNO Junkies 16. CHNO Junkies 1 pt. 9,147

  1. Avatar for hansvandenhof 31. hansvandenhof Lv 1 42 pts. 9,766
  2. Avatar for jobo0502 32. jobo0502 Lv 1 40 pts. 9,754
  3. Avatar for gmn 33. gmn Lv 1 39 pts. 9,751
  4. Avatar for DodoBird 34. DodoBird Lv 1 38 pts. 9,737
  5. Avatar for joremen 35. joremen Lv 1 37 pts. 9,729
  6. Avatar for TomTaylor 36. TomTaylor Lv 1 36 pts. 9,727
  7. Avatar for Mark- 37. Mark- Lv 1 34 pts. 9,723
  8. Avatar for Vinara 38. Vinara Lv 1 33 pts. 9,703
  9. Avatar for tallguy-13088 39. tallguy-13088 Lv 1 32 pts. 9,702
  10. Avatar for hpaege 40. hpaege Lv 1 31 pts. 9,689

Comments