Placeholder image of a protein
Icon representing a puzzle

1232: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
May 11, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups


  1. Avatar for Beta Folders 100 pts. 10,172
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 9,965
  3. Avatar for Go Science 3. Go Science 49 pts. 9,958
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 9,955
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 9,938
  6. Avatar for Contenders 6. Contenders 14 pts. 9,916
  7. Avatar for HMT heritage 7. HMT heritage 8 pts. 9,901
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 5 pts. 9,882
  9. Avatar for D001x Med Chem MOOC 9. D001x Med Chem MOOC 3 pts. 9,642
  10. Avatar for Deleted group 10. Deleted group pts. 9,637

  1. Avatar for hansvandenhof 31. hansvandenhof Lv 1 42 pts. 9,766
  2. Avatar for jobo0502 32. jobo0502 Lv 1 40 pts. 9,754
  3. Avatar for gmn 33. gmn Lv 1 39 pts. 9,751
  4. Avatar for DodoBird 34. DodoBird Lv 1 38 pts. 9,737
  5. Avatar for joremen 35. joremen Lv 1 37 pts. 9,729
  6. Avatar for TomTaylor 36. TomTaylor Lv 1 36 pts. 9,727
  7. Avatar for Mark- 37. Mark- Lv 1 34 pts. 9,723
  8. Avatar for Vinara 38. Vinara Lv 1 33 pts. 9,703
  9. Avatar for tallguy-13088 39. tallguy-13088 Lv 1 32 pts. 9,702
  10. Avatar for hpaege 40. hpaege Lv 1 31 pts. 9,689

Comments