Placeholder image of a protein
Icon representing a puzzle

1234: Unsolved De-novo Freestyle 79: Predicted Contacts

Closed since almost 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
May 16, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1231, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1231 and use them as a starting point here.



Sequence:


MDAPASFSLGAMGPLLRKLDSLLVAPEIRLPKPLKEGIELLKEDLEEIGVSLVEHSVVDSPTHKARFWMDEVRDLSYHIEDCIDTMFSMRSGGDDGKPRSERRHKVGRAKIDGFSKKPKPCTRMARIAELRALVREASERLERYQLGDVCGSSS

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 15,173
  2. Avatar for Void Crushers 2. Void Crushers 77 pts. 14,460
  3. Avatar for Gargleblasters 3. Gargleblasters 58 pts. 14,455
  4. Avatar for Beta Folders 4. Beta Folders 43 pts. 14,225
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 14,199
  6. Avatar for Go Science 6. Go Science 22 pts. 14,017
  7. Avatar for Contenders 7. Contenders 15 pts. 13,840
  8. Avatar for Deleted group 8. Deleted group pts. 13,363
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 12,756
  10. Avatar for xkcd 10. xkcd 5 pts. 12,201

  1. Avatar for Susume
    1. Susume Lv 1
    100 pts. 15,122
  2. Avatar for MurloW 2. MurloW Lv 1 98 pts. 14,810
  3. Avatar for Madde 3. Madde Lv 1 96 pts. 14,460
  4. Avatar for grogar7 4. grogar7 Lv 1 93 pts. 14,413
  5. Avatar for Skippysk8s 5. Skippysk8s Lv 1 91 pts. 14,398
  6. Avatar for frood66 6. frood66 Lv 1 89 pts. 14,343
  7. Avatar for pmdpmd 7. pmdpmd Lv 1 87 pts. 14,199
  8. Avatar for retiredmichael 8. retiredmichael Lv 1 85 pts. 14,141
  9. Avatar for Galaxie 9. Galaxie Lv 1 83 pts. 14,121
  10. Avatar for martin.szew 10. martin.szew Lv 1 81 pts. 14,034

Comments