Placeholder image of a protein
Icon representing a puzzle

1234: Unsolved De-novo Freestyle 79: Predicted Contacts

Closed since almost 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
May 16, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1231, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1231 and use them as a starting point here.



Sequence:


MDAPASFSLGAMGPLLRKLDSLLVAPEIRLPKPLKEGIELLKEDLEEIGVSLVEHSVVDSPTHKARFWMDEVRDLSYHIEDCIDTMFSMRSGGDDGKPRSERRHKVGRAKIDGFSKKPKPCTRMARIAELRALVREASERLERYQLGDVCGSSS

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 3 pts. 12,113
  2. Avatar for SETI.Germany 12. SETI.Germany 2 pts. 12,102
  3. Avatar for D001x Med Chem MOOC 13. D001x Med Chem MOOC 1 pt. 12,098
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 12,042
  5. Avatar for CHNO Junkies 15. CHNO Junkies 1 pt. 11,714
  6. Avatar for It's over 9000! 16. It's over 9000! 1 pt. 11,610
  7. Avatar for Advanced Protein Science 2 - 2016 17. Advanced Protein Science 2 - 2016 1 pt. 7,572
  8. Avatar for foldeRNA 18. foldeRNA 1 pt. 6,429
  9. Avatar for Student group 19. Student group 1 pt. 0
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 0
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 15,173
  2. Avatar for lamoille 2. lamoille Lv 1 89 pts. 15,158
  3. Avatar for phi16 3. phi16 Lv 1 78 pts. 15,104
  4. Avatar for jamiexq 4. jamiexq Lv 1 69 pts. 15,076
  5. Avatar for alwen 5. alwen Lv 1 60 pts. 15,074
  6. Avatar for gmn 6. gmn Lv 1 53 pts. 15,074
  7. Avatar for hansvandenhof 7. hansvandenhof Lv 1 46 pts. 15,071
  8. Avatar for alcor29 8. alcor29 Lv 1 40 pts. 14,901
  9. Avatar for Mike Lewis 9. Mike Lewis Lv 1 34 pts. 14,455
  10. Avatar for actiasluna 10. actiasluna Lv 1 29 pts. 14,452

Comments