Placeholder image of a protein
Icon representing a puzzle

1234: Unsolved De-novo Freestyle 79: Predicted Contacts

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Predicted Contacts Predicted Contacts Predicted Contacts Predicted Contacts Predicted Contacts Predicted Contacts Predicted Contacts Predicted Contacts Predicted Contacts

Summary


Created
May 16, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1231, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1231 and use them as a starting point here.



Sequence:


MDAPASFSLGAMGPLLRKLDSLLVAPEIRLPKPLKEGIELLKEDLEEIGVSLVEHSVVDSPTHKARFWMDEVRDLSYHIEDCIDTMFSMRSGGDDGKPRSERRHKVGRAKIDGFSKKPKPCTRMARIAELRALVREASERLERYQLGDVCGSSS

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 3 pts. 12,113
  2. Avatar for SETI.Germany 12. SETI.Germany 2 pts. 12,102
  3. Avatar for D001x Med Chem MOOC 13. D001x Med Chem MOOC 1 pt. 12,098
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 12,042
  5. Avatar for CHNO Junkies 15. CHNO Junkies 1 pt. 11,714
  6. Avatar for It's over 9000! 16. It's over 9000! 1 pt. 11,610
  7. Avatar for foldeRNA 18. foldeRNA 1 pt. 6,429
  8. Avatar for Student group 19. Student group 1 pt. 0
  9. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 0

  1. Avatar for Alistair69 111. Alistair69 Lv 1 3 pts. 11,384
  2. Avatar for Petrifolder 112. Petrifolder Lv 1 3 pts. 11,374
  3. Avatar for Punktchen 113. Punktchen Lv 1 3 pts. 11,354
  4. Avatar for abiogenesis 114. abiogenesis Lv 1 2 pts. 11,335
  5. Avatar for taminnugget 115. taminnugget Lv 1 2 pts. 11,313
  6. Avatar for miquel94 116. miquel94 Lv 1 2 pts. 11,203
  7. Avatar for ecali 117. ecali Lv 1 2 pts. 11,203
  8. Avatar for WBarme1234 118. WBarme1234 Lv 1 2 pts. 11,199
  9. Avatar for placid.lion 119. placid.lion Lv 1 2 pts. 11,111
  10. Avatar for inuyasha10121 120. inuyasha10121 Lv 1 2 pts. 10,972

Comments