Placeholder image of a protein
Icon representing a puzzle

1234: Unsolved De-novo Freestyle 79: Predicted Contacts

Closed since almost 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
May 16, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1231, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1231 and use them as a starting point here.



Sequence:


MDAPASFSLGAMGPLLRKLDSLLVAPEIRLPKPLKEGIELLKEDLEEIGVSLVEHSVVDSPTHKARFWMDEVRDLSYHIEDCIDTMFSMRSGGDDGKPRSERRHKVGRAKIDGFSKKPKPCTRMARIAELRALVREASERLERYQLGDVCGSSS

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 3 pts. 12,113
  2. Avatar for SETI.Germany 12. SETI.Germany 2 pts. 12,102
  3. Avatar for D001x Med Chem MOOC 13. D001x Med Chem MOOC 1 pt. 12,098
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 12,042
  5. Avatar for CHNO Junkies 15. CHNO Junkies 1 pt. 11,714
  6. Avatar for It's over 9000! 16. It's over 9000! 1 pt. 11,610
  7. Avatar for foldeRNA 18. foldeRNA 1 pt. 6,429
  8. Avatar for Student group 19. Student group 1 pt. 0
  9. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 0

  1. Avatar for penteplayer 181. penteplayer Lv 1 1 pt. 2,737
  2. Avatar for zkm 182. zkm Lv 1 1 pt. 2,622
  3. Avatar for blakeisu 183. blakeisu Lv 1 1 pt. 2,499
  4. Avatar for rezaefar 184. rezaefar Lv 1 1 pt. 2,489
  5. Avatar for suchomim 185. suchomim Lv 1 1 pt. 2,473
  6. Avatar for Zun 186. Zun Lv 1 1 pt. 2,154
  7. Avatar for Cloud9 187. Cloud9 Lv 1 1 pt. 2,121
  8. Avatar for Neko42 188. Neko42 Lv 1 1 pt. 1,575
  9. Avatar for Ominom 189. Ominom Lv 1 1 pt. 1,561
  10. Avatar for earmark 190. earmark Lv 1 1 pt. 1,554

Comments