Placeholder image of a protein
Icon representing a puzzle

1234: Unsolved De-novo Freestyle 79: Predicted Contacts

Closed since almost 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
May 16, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1231, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1231 and use them as a starting point here.



Sequence:


MDAPASFSLGAMGPLLRKLDSLLVAPEIRLPKPLKEGIELLKEDLEEIGVSLVEHSVVDSPTHKARFWMDEVRDLSYHIEDCIDTMFSMRSGGDDGKPRSERRHKVGRAKIDGFSKKPKPCTRMARIAELRALVREASERLERYQLGDVCGSSS

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 3 pts. 12,113
  2. Avatar for SETI.Germany 12. SETI.Germany 2 pts. 12,102
  3. Avatar for D001x Med Chem MOOC 13. D001x Med Chem MOOC 1 pt. 12,098
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 12,042
  5. Avatar for CHNO Junkies 15. CHNO Junkies 1 pt. 11,714
  6. Avatar for It's over 9000! 16. It's over 9000! 1 pt. 11,610
  7. Avatar for Advanced Protein Science 2 - 2016 17. Advanced Protein Science 2 - 2016 1 pt. 7,572
  8. Avatar for foldeRNA 18. foldeRNA 1 pt. 6,429
  9. Avatar for Student group 19. Student group 1 pt. 0
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 0
  1. Avatar for drumpeter18yrs9yrs 31. drumpeter18yrs9yrs Lv 1 46 pts. 13,363
  2. Avatar for johnmitch 32. johnmitch Lv 1 45 pts. 13,351
  3. Avatar for alwen 33. alwen Lv 1 44 pts. 13,346
  4. Avatar for pauldunn 34. pauldunn Lv 1 42 pts. 13,341
  5. Avatar for reefyrob 35. reefyrob Lv 1 41 pts. 13,327
  6. Avatar for caglar 36. caglar Lv 1 40 pts. 13,320
  7. Avatar for dcrwheeler 37. dcrwheeler Lv 1 39 pts. 13,303
  8. Avatar for dembones 38. dembones Lv 1 38 pts. 13,297
  9. Avatar for mimi 39. mimi Lv 1 37 pts. 13,279
  10. Avatar for jamiexq 40. jamiexq Lv 1 36 pts. 13,275

Comments