Placeholder image of a protein
Icon representing a puzzle

1234: Unsolved De-novo Freestyle 79: Predicted Contacts

Closed since almost 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
May 16, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1231, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1231 and use them as a starting point here.



Sequence:


MDAPASFSLGAMGPLLRKLDSLLVAPEIRLPKPLKEGIELLKEDLEEIGVSLVEHSVVDSPTHKARFWMDEVRDLSYHIEDCIDTMFSMRSGGDDGKPRSERRHKVGRAKIDGFSKKPKPCTRMARIAELRALVREASERLERYQLGDVCGSSS

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 3 pts. 12,113
  2. Avatar for SETI.Germany 12. SETI.Germany 2 pts. 12,102
  3. Avatar for D001x Med Chem MOOC 13. D001x Med Chem MOOC 1 pt. 12,098
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 12,042
  5. Avatar for CHNO Junkies 15. CHNO Junkies 1 pt. 11,714
  6. Avatar for It's over 9000! 16. It's over 9000! 1 pt. 11,610
  7. Avatar for foldeRNA 18. foldeRNA 1 pt. 6,429
  8. Avatar for Student group 19. Student group 1 pt. 0
  9. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 0

  1. Avatar for snakeguy 51. snakeguy Lv 1 26 pts. 12,933
  2. Avatar for Blipperman 52. Blipperman Lv 1 25 pts. 12,926
  3. Avatar for Merf 53. Merf Lv 1 24 pts. 12,892
  4. Avatar for Museka 54. Museka Lv 1 23 pts. 12,878
  5. Avatar for jeff101 55. jeff101 Lv 1 23 pts. 12,856
  6. Avatar for phi16 56. phi16 Lv 1 22 pts. 12,827
  7. Avatar for Bautho 57. Bautho Lv 1 21 pts. 12,798
  8. Avatar for nemo7731 58. nemo7731 Lv 1 20 pts. 12,748
  9. Avatar for WarpSpeed 59. WarpSpeed Lv 1 20 pts. 12,679
  10. Avatar for DodoBird 60. DodoBird Lv 1 19 pts. 12,670

Comments