Placeholder image of a protein
Icon representing a puzzle

1234: Unsolved De-novo Freestyle 79: Predicted Contacts

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Predicted Contacts Predicted Contacts Predicted Contacts Predicted Contacts Predicted Contacts Predicted Contacts Predicted Contacts Predicted Contacts Predicted Contacts

Summary


Created
May 16, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1231, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1231 and use them as a starting point here.



Sequence:


MDAPASFSLGAMGPLLRKLDSLLVAPEIRLPKPLKEGIELLKEDLEEIGVSLVEHSVVDSPTHKARFWMDEVRDLSYHIEDCIDTMFSMRSGGDDGKPRSERRHKVGRAKIDGFSKKPKPCTRMARIAELRALVREASERLERYQLGDVCGSSS

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 3 pts. 12,113
  2. Avatar for SETI.Germany 12. SETI.Germany 2 pts. 12,102
  3. Avatar for D001x Med Chem MOOC 13. D001x Med Chem MOOC 1 pt. 12,098
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 12,042
  5. Avatar for CHNO Junkies 15. CHNO Junkies 1 pt. 11,714
  6. Avatar for It's over 9000! 16. It's over 9000! 1 pt. 11,610
  7. Avatar for foldeRNA 18. foldeRNA 1 pt. 6,429
  8. Avatar for Student group 19. Student group 1 pt. 0
  9. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 0

  1. Avatar for cynwulf28 61. cynwulf28 Lv 1 19 pts. 12,637
  2. Avatar for Vinara 62. Vinara Lv 1 18 pts. 12,610
  3. Avatar for fishercat 63. fishercat Lv 1 17 pts. 12,605
  4. Avatar for justjustin 64. justjustin Lv 1 17 pts. 12,543
  5. Avatar for NinjaGreg 65. NinjaGreg Lv 1 16 pts. 12,539
  6. Avatar for O Seki To 66. O Seki To Lv 1 16 pts. 12,523
  7. Avatar for andrewxc 67. andrewxc Lv 1 15 pts. 12,483
  8. Avatar for tallguy-13088 68. tallguy-13088 Lv 1 15 pts. 12,473
  9. Avatar for poiuyqwert 69. poiuyqwert Lv 1 14 pts. 12,460
  10. Avatar for yoyoparis 70. yoyoparis Lv 1 14 pts. 12,452

Comments