1234: Unsolved De-novo Freestyle 79: Predicted Contacts

Closed since almost 10 years ago

Summary

• Created: May 16, 2016
• Expires: May 23, 2016 at 23:00 UTC
• Max points: 100

Description

This is a follow-up puzzle for Puzzle 1231, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1231 and use them as a starting point here.



Sequence:

MDAPASFSLGAMGPLLRKLDSLLVAPEIRLPKPLKEGIELLKEDLEEIGVSLVEHSVVDSPTHKARFWMDEVRDLSYHIEDCIDTMFSMRSGGDDGKPRSERRHKVGRAKIDGFSKKPKPCTRMARIAELRALVREASERLERYQLGDVCGSSS

Top groups

• 1. Anthropic Dreams 100 pts. 15,173
• 2. Void Crushers 77 pts. 14,460
• 3. Gargleblasters 58 pts. 14,455
• 4. Beta Folders 43 pts. 14,225
• 5. L'Alliance Francophone 31 pts. 14,199
• 6. Go Science 22 pts. 14,017
• 7. Contenders 15 pts. 13,840
• 8. Deleted group pts. 13,363
• 9. HMT heritage 7 pts. 12,756
• 10. xkcd 5 pts. 12,201

Top evolvers

• 1. Galaxie 100 pts. 15,173
• 2. lamoille 89 pts. 15,158
• 3. phi16 78 pts. 15,104
• 4. jamiexq 69 pts. 15,076
• 5. alwen 60 pts. 15,074
• 6. gmn 53 pts. 15,074
• 7. hansvandenhof 46 pts. 15,071
• 8. alcor29 40 pts. 14,901
• 9. Mike Lewis 34 pts. 14,455
• 10. actiasluna 29 pts. 14,452

Comments

[jeff101]

http://foldit.wikia.com/wiki/Distance_Maps and http://memorize.com/distance-and-contact-maps show Distance and Contact Maps along-side their respective 3D images for many different proteins. Images are classified as in the SCOPe database (http://scop.berkeley.edu), and http://memorize.com/distance-and-contact-maps can shuffle the images in multiple-choice and matching modes to help you learn the patterns in them.