Placeholder image of a protein
Icon representing a puzzle

1234: Unsolved De-novo Freestyle 79: Predicted Contacts

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Predicted Contacts Predicted Contacts Predicted Contacts Predicted Contacts Predicted Contacts Predicted Contacts Predicted Contacts Predicted Contacts Predicted Contacts

Summary


Created
May 16, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1231, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1231 and use them as a starting point here.



Sequence:


MDAPASFSLGAMGPLLRKLDSLLVAPEIRLPKPLKEGIELLKEDLEEIGVSLVEHSVVDSPTHKARFWMDEVRDLSYHIEDCIDTMFSMRSGGDDGKPRSERRHKVGRAKIDGFSKKPKPCTRMARIAELRALVREASERLERYQLGDVCGSSS

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 15,173
  2. Avatar for Void Crushers 2. Void Crushers 77 pts. 14,460
  3. Avatar for Gargleblasters 3. Gargleblasters 58 pts. 14,455
  4. Avatar for Beta Folders 4. Beta Folders 43 pts. 14,225
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 14,199
  6. Avatar for Go Science 6. Go Science 22 pts. 14,017
  7. Avatar for Contenders 7. Contenders 15 pts. 13,840
  8. Avatar for Deleted group 8. Deleted group pts. 13,363
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 12,756
  10. Avatar for xkcd 10. xkcd 5 pts. 12,201

  1. Avatar for demeter900 161. demeter900 Lv 1 1 pt. 5,851
  2. Avatar for GreekCivilization 162. GreekCivilization Lv 1 1 pt. 5,618
  3. Avatar for lamoille 163. lamoille Lv 1 1 pt. 5,579
  4. Avatar for MemeMachine 164. MemeMachine Lv 1 1 pt. 4,950
  5. Avatar for lockert 165. lockert Lv 1 1 pt. 4,906
  6. Avatar for sean4046 166. sean4046 Lv 1 1 pt. 4,572
  7. Avatar for YumatovShow 167. YumatovShow Lv 1 1 pt. 4,162
  8. Avatar for noforgiven 168. noforgiven Lv 1 1 pt. 4,139
  9. Avatar for TraeKooi 169. TraeKooi Lv 1 1 pt. 4,122
  10. Avatar for roman madala 170. roman madala Lv 1 1 pt. 4,056

Comments