Placeholder image of a protein
Icon representing a puzzle

1234: Unsolved De-novo Freestyle 79: Predicted Contacts

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Predicted Contacts Predicted Contacts Predicted Contacts Predicted Contacts Predicted Contacts Predicted Contacts Predicted Contacts Predicted Contacts Predicted Contacts

Summary


Created
May 16, 2016
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1231, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1231 and use them as a starting point here.



Sequence:


MDAPASFSLGAMGPLLRKLDSLLVAPEIRLPKPLKEGIELLKEDLEEIGVSLVEHSVVDSPTHKARFWMDEVRDLSYHIEDCIDTMFSMRSGGDDGKPRSERRHKVGRAKIDGFSKKPKPCTRMARIAELRALVREASERLERYQLGDVCGSSS

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 15,173
  2. Avatar for Void Crushers 2. Void Crushers 77 pts. 14,460
  3. Avatar for Gargleblasters 3. Gargleblasters 58 pts. 14,455
  4. Avatar for Beta Folders 4. Beta Folders 43 pts. 14,225
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 14,199
  6. Avatar for Go Science 6. Go Science 22 pts. 14,017
  7. Avatar for Contenders 7. Contenders 15 pts. 13,840
  8. Avatar for Deleted group 8. Deleted group pts. 13,363
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 12,756
  10. Avatar for xkcd 10. xkcd 5 pts. 12,201

  1. Avatar for johngran 171. johngran Lv 1 1 pt. 3,908
  2. Avatar for Hansie 172. Hansie Lv 1 1 pt. 3,852
  3. Avatar for grapesie 173. grapesie Lv 1 1 pt. 3,623
  4. Avatar for GingerInferno 174. GingerInferno Lv 1 1 pt. 3,561
  5. Avatar for ventus14 175. ventus14 Lv 1 1 pt. 3,463
  6. Avatar for Stephen R 176. Stephen R Lv 1 1 pt. 3,158
  7. Avatar for AldenMCB 177. AldenMCB Lv 1 1 pt. 3,085
  8. Avatar for Kaosw 178. Kaosw Lv 1 1 pt. 3,004
  9. Avatar for Purt 179. Purt Lv 1 1 pt. 2,999
  10. Avatar for cherry39 180. cherry39 Lv 1 1 pt. 2,745

Comments