Placeholder image of a protein
Icon representing a puzzle

1235: Revisiting Puzzle 165: Rosetta Decoy 15

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
May 17, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The protein contains four cysteine residues, but only two oxidize to form a single disulfide bond. The starting structure is a Rosetta model. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Deleted group 11. Deleted group pts. 9,687
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,570
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,418
  4. Avatar for xkcd 14. xkcd 1 pt. 9,214
  5. Avatar for Australia 15. Australia 1 pt. 9,141
  6. Avatar for SETI.Germany 16. SETI.Germany 1 pt. 9,066
  7. Avatar for LCC Organic Chemistry 17. LCC Organic Chemistry 1 pt. 9,011
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 8,901

  1. Avatar for Inkedhands 121. Inkedhands Lv 1 1 pt. 9,224
  2. Avatar for dbuske 122. dbuske Lv 1 1 pt. 9,223
  3. Avatar for martinf 123. martinf Lv 1 1 pt. 9,217
  4. Avatar for fryguy 124. fryguy Lv 1 1 pt. 9,214
  5. Avatar for hada 125. hada Lv 1 1 pt. 9,213
  6. Avatar for Tac1 126. Tac1 Lv 1 1 pt. 9,191
  7. Avatar for xavierhochart 127. xavierhochart Lv 1 1 pt. 9,177
  8. Avatar for aznarog 128. aznarog Lv 1 1 pt. 9,162
  9. Avatar for Blakenator 129. Blakenator Lv 1 1 pt. 9,146
  10. Avatar for willanth 130. willanth Lv 1 1 pt. 9,141

Comments