1235: Revisiting Puzzle 165: Rosetta Decoy 15

Closed since almost 10 years ago

Summary

• Created: May 17, 2016
• Expires: May 25, 2016 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The protein contains four cysteine residues, but only two oxidize to form a single disulfide bond. The starting structure is a Rosetta model. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

• 1. Beta Folders 100 pts. 10,215
• 2. Gargleblasters 74 pts. 10,089
• 3. Contenders 54 pts. 10,008
• 4. Go Science 38 pts. 9,997
• 5. Anthropic Dreams 27 pts. 9,969
• 6. Void Crushers 18 pts. 9,901
• 7. HMT heritage 12 pts. 9,889
• 8. L'Alliance Francophone 8 pts. 9,889
• 9. D001x Med Chem MOOC 5 pts. 9,847
• 10. It's over 9000! 3 pts. 9,712

Top soloists

• 11. pauldunn 77 pts. 9,933
• 12. johnmitch 75 pts. 9,921
• 13. mirp 73 pts. 9,909
• 14. Bletchley Park 71 pts. 9,908
• 15. hpaege 69 pts. 9,904
• 16. Deleted player pts. 9,903
• 17. Timo van der Laan 66 pts. 9,901
• 18. dcrwheeler 64 pts. 9,899
• 19. christioanchauvin 62 pts. 9,889
• 20. O Seki To 60 pts. 9,885