Placeholder image of a protein
Icon representing a puzzle

1235: Revisiting Puzzle 165: Rosetta Decoy 15

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 17, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The protein contains four cysteine residues, but only two oxidize to form a single disulfide bond. The starting structure is a Rosetta model. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Beta Folders 100 pts. 10,215
  2. Avatar for Gargleblasters 2. Gargleblasters 74 pts. 10,089
  3. Avatar for Contenders 3. Contenders 54 pts. 10,008
  4. Avatar for Go Science 4. Go Science 38 pts. 9,997
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 9,969
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 9,901
  7. Avatar for HMT heritage 7. HMT heritage 12 pts. 9,889
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 9,889
  9. Avatar for D001x Med Chem MOOC 9. D001x Med Chem MOOC 5 pts. 9,847
  10. Avatar for It's over 9000! 10. It's over 9000! 3 pts. 9,712

  1. Avatar for tallguy-13088 41. tallguy-13088 Lv 1 32 pts. 9,763
  2. Avatar for pvc78 42. pvc78 Lv 1 31 pts. 9,761
  3. Avatar for guineapig 43. guineapig Lv 1 30 pts. 9,758
  4. Avatar for smholst 44. smholst Lv 1 29 pts. 9,753
  5. Avatar for Museka 45. Museka Lv 1 28 pts. 9,735
  6. Avatar for greepski 46. greepski Lv 1 27 pts. 9,735
  7. Avatar for Mark- 47. Mark- Lv 1 26 pts. 9,734
  8. Avatar for jamiexq 48. jamiexq Lv 1 25 pts. 9,733
  9. Avatar for cbwest 49. cbwest Lv 1 25 pts. 9,729
  10. Avatar for caglar 50. caglar Lv 1 24 pts. 9,728

Comments