Placeholder image of a protein
Icon representing a puzzle

1235: Revisiting Puzzle 165: Rosetta Decoy 15

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
May 17, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The protein contains four cysteine residues, but only two oxidize to form a single disulfide bond. The starting structure is a Rosetta model. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,215
  2. Avatar for Gargleblasters 2. Gargleblasters 74 pts. 10,089
  3. Avatar for Contenders 3. Contenders 54 pts. 10,008
  4. Avatar for Go Science 4. Go Science 38 pts. 9,997
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 9,969
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 9,901
  7. Avatar for HMT heritage 7. HMT heritage 12 pts. 9,889
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 9,889
  9. Avatar for D001x Med Chem MOOC 9. D001x Med Chem MOOC 5 pts. 9,847
  10. Avatar for It's over 9000! 10. It's over 9000! 3 pts. 9,712
  1. Avatar for ViJay7019 61. ViJay7019 Lv 1 16 pts. 9,682
  2. Avatar for SKSbell 62. SKSbell Lv 1 16 pts. 9,667
  3. Avatar for grogar7 63. grogar7 Lv 1 15 pts. 9,658
  4. Avatar for froggs554 64. froggs554 Lv 1 15 pts. 9,656
  5. Avatar for stomjoh 65. stomjoh Lv 1 14 pts. 9,638
  6. Avatar for DodoBird 66. DodoBird Lv 1 13 pts. 9,630
  7. Avatar for Deleted player 67. Deleted player pts. 9,628
  8. Avatar for altejoh 68. altejoh Lv 1 13 pts. 9,623
  9. Avatar for Vinara 69. Vinara Lv 1 12 pts. 9,621
  10. Avatar for WarpSpeed 70. WarpSpeed Lv 1 12 pts. 9,619

Comments